# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_1056.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_1056 [L=155] Description: # 1164963 # 1165427 # 1 # ID=1_1056;partial=00;start_type=ATG;rbs_motif=AGGAG;rbs_spacer=5-10bp;gc_cont=0.314 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-28 99.2 0.1 1.9e-28 98.4 0.0 1.4 2 SSB Single-strand binding protein family Domain annotation for each model (and alignments): >> SSB Single-strand binding protein family # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.4 0.0 1.2e-32 1.9e-28 1 103 [. 1 102 [. 1 103 [. 0.98 2 ? -3.1 0.0 0.46 7.6e+03 19 32 .. 118 131 .. 110 141 .. 0.56 Alignments for each domain: == domain 1 score: 98.4 bits; conditional E-value: 1.2e-32 ECEEEEEEEESSS-EEEEETTSEEEEEEEEEEEEEEEETTCCEEEEEEEEEEEEEHHHHHHHHHH--TT-EEEEEEEEEEEEE CS SSB 1 vnkvilvGrlgkdpelrqtesGnavarftlatnrrfkdqegekdeetewhrvvvfgklaevvaeylkkGslvyveGrlqtrky 83 +n v+l Grl++dpel++ +sG+a+ rf++a++r f+++++++ + ++++++v+fgk+ae++ ey +kG +++++Grlq+++y 23726_FusoPortal_Gene_1056 1 MNLVVLNGRLTRDPELKFGQSGKAYSRFSIAVDRPFQSSSDKNSQTADFINCVAFGKTAEFIGEYFRKGRKILLNGRLQMSQY 83 899******************************************************************************** PP ECTTSCEEEEEEEEEEEEEE CS SSB 84 edqegqkrysteivaeevqf 103 e + g+k +++ ++a++v+f 23726_FusoPortal_Gene_1056 84 ESE-GKKITTYVVIADSVEF 102 *99.*9***********997 PP == domain 2 score: -3.1 bits; conditional E-value: 0.46 ETTSEEEEEEEEEE CS SSB 19 tesGnavarftlat 32 +s+ + ++ t++t 23726_FusoPortal_Gene_1056 118 GRSESKSTNNTIET 131 44444555555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (155 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 459 (0.0274653); expected 334.2 (0.02) Passed bias filter: 331 (0.0198061); expected 334.2 (0.02) Passed Vit filter: 19 (0.00113691); expected 16.7 (0.001) Passed Fwd filter: 1 (5.98372e-05); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.24u 0.25s 00:00:00.49 Elapsed: 00:00:00.32 # Mc/sec: 1408.09 // [ok]