# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_1070.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_1070 [L=73] Description: # 1176913 # 1177131 # 1 # ID=1_1070;partial=00;start_type=TTG;rbs_motif=None;rbs_spacer=None;gc_cont=0.215 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-12 46.6 0.0 3e-12 46.5 0.0 1.1 1 Acetyltransf_10 Acetyltransferase (GNAT) domain Domain annotation for each model (and alignments): >> Acetyltransf_10 Acetyltransferase (GNAT) domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.5 0.0 1.8e-16 3e-12 78 126 .. 18 66 .. 8 67 .. 0.83 Alignments for each domain: == domain 1 score: 46.5 bits; conditional E-value: 1.8e-16 Acetyltransf_10 78 eeaekdglkleltvnaspyavpfYeklGFkavgeeqeenGirfvpMeke 126 ++ +++ +l + vn+s+y vp+YeklGF++++ee+e++G++f+pM++ 23726_FusoPortal_Gene_1070 18 IYFLNNNENLYIRVNSSRYGVPIYEKLGFVKMEEEKERDGLKFTPMKLV 66 4543444444************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (73 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 526 (0.0314744); expected 334.2 (0.02) Passed bias filter: 303 (0.0181307); expected 334.2 (0.02) Passed Vit filter: 26 (0.00155577); expected 16.7 (0.001) Passed Fwd filter: 1 (5.98372e-05); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.21u 0.23s 00:00:00.44 Elapsed: 00:00:00.31 # Mc/sec: 684.56 // [ok]