# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_1078.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_1078 [L=38] Description: # 1185821 # 1185934 # 1 # ID=1_1078;partial=00;start_type=ATG;rbs_motif=AGGAGG;rbs_spacer=5-10bp;gc_cont=0.263 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-16 59.1 9.9 3.6e-16 59.0 9.9 1.0 1 Ribosomal_L36 Ribosomal protein L36 Domain annotation for each model (and alignments): >> Ribosomal_L36 Ribosomal protein L36 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.0 9.9 2.2e-20 3.6e-16 1 38 [] 1 37 [. 1 37 [. 0.99 Alignments for each domain: == domain 1 score: 59.0 bits; conditional E-value: 2.2e-20 Ribosomal_L36 1 MKVrssvkkmcegCkvvrRkgrvyviCkknPrhKqRQG 38 MKVr s+k +c++Ck+++R+g+++viC +nP+hKq QG 23726_FusoPortal_Gene_1078 1 MKVRVSIKPICDKCKIIKRHGKIRVIC-ENPKHKQVQG 37 ***************************.*********9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (38 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 609 (0.0364409); expected 334.2 (0.02) Passed bias filter: 304 (0.0181905); expected 334.2 (0.02) Passed Vit filter: 21 (0.00125658); expected 16.7 (0.001) Passed Fwd filter: 1 (5.98372e-05); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.21u 0.23s 00:00:00.44 Elapsed: 00:00:00.31 # Mc/sec: 356.35 // [ok]