# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_1096.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_1096 [L=208] Description: # 1203980 # 1204603 # 1 # ID=1_1096;partial=00;start_type=ATG;rbs_motif=GGAG/GAGG;rbs_spacer=5-10bp;gc_cont=0.269 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-18 63.9 0.0 9.8e-18 63.4 0.0 1.3 1 DUF374 Domain of unknown function (DUF374) Domain annotation for each model (and alignments): >> DUF374 Domain of unknown function (DUF374) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.4 0.0 5.8e-22 9.8e-18 8 68 .. 63 123 .. 56 124 .. 0.92 Alignments for each domain: == domain 1 score: 63.4 bits; conditional E-value: 5.8e-22 DUF374 8 laaliSrsrDGeliarvlerlGiktirGSsskggaealremlralkegesvaitpDgPrGP 68 a+ S +DGeli+ le++G+ ++rGSs+k++ + ++++l++lk+g+s++ DgP+GP 23726_FusoPortal_Gene_1096 63 KLAMSSPTKDGELISVPLEKMGYILVRGSSDKNQISSTISLLKYLKKGYSIGTPLDGPKGP 123 459*************************************************888****** PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (208 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 434 (0.0259694); expected 334.2 (0.02) Passed bias filter: 375 (0.022439); expected 334.2 (0.02) Passed Vit filter: 29 (0.00173528); expected 16.7 (0.001) Passed Fwd filter: 1 (5.98372e-05); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.24u 0.24s 00:00:00.48 Elapsed: 00:00:00.32 # Mc/sec: 1889.57 // [ok]