# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_1108.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_1108 [L=157] Description: # 1216522 # 1216992 # 1 # ID=1_1108;partial=00;start_type=ATG;rbs_motif=GGAG/GAGG;rbs_spacer=5-10bp;gc_cont=0.231 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-28 98.1 10.7 3.9e-28 97.9 10.7 1.0 1 DctQ Tripartite ATP-independent periplasmic transpor Domain annotation for each model (and alignments): >> DctQ Tripartite ATP-independent periplasmic transporters, DctQ component # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.9 10.7 2.3e-32 3.9e-28 2 131 .. 21 148 .. 20 149 .. 0.97 Alignments for each domain: == domain 1 score: 97.9 bits; conditional E-value: 2.3e-32 DctQ 2 vllvlaqvflRyllnsslpwteelarylfvwlvflgaalalrrgshirvdllverlpprvrrlleliadllallfaavliwag 84 +++v+++vf+Ry+l+ + w+ee+a+ +fvw++flg a+a+r+++ i v++++ +lp+++r+++e+++ +l+ ++++++++++ 23726_FusoPortal_Gene_1108 21 IIVVIINVFTRYFLKFTYFWSEEVAVGCFVWTIFLGTAAAYREKGLIGVEAIIVLLPEKIRNIVEFLTYILLTVLSGLMCVFS 103 689**********988888**************************************************************** PP DctQ 85 wlevaaalfeettpvlglplwwvylvlpigaallalvalarllrllr 131 + ++++ + + t++l+l+++++ ++++i++al++l+++ ++++l+ 23726_FusoPortal_Gene_1108 104 F--TYVMSSSKITAALELSYGYINFSIVISFALMTLYSIIFTIESLK 148 *..************************************99999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (157 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 1131 (0.0676759); expected 334.2 (0.02) Passed bias filter: 290 (0.0173528); expected 334.2 (0.02) Passed Vit filter: 35 (0.0020943); expected 16.7 (0.001) Passed Fwd filter: 3 (0.000179512); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.29u 0.27s 00:00:00.56 Elapsed: 00:00:00.38 # Mc/sec: 1201.06 // [ok]