# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_1148.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_1148 [L=201] Description: # 1251374 # 1251976 # 1 # ID=1_1148;partial=00;start_type=ATG;rbs_motif=GGAG/GAGG;rbs_spacer=5-10bp;gc_cont=0.240 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-31 110.9 9.8 1.4e-18 67.8 0.5 2.1 2 DUF445 Protein of unknown function (DUF445) 0.0055 16.3 6.9 0.011 15.3 6.9 1.4 1 DUF5095 Domain of unknown function (DUF5095) ------ inclusion threshold ------ 3.1 7.9 6.3 1.5 8.9 2.3 2.1 2 SRI SRI (Set2 Rpb1 interacting) domain Domain annotation for each model (and alignments): >> DUF445 Protein of unknown function (DUF445) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.8 0.5 2.5e-22 1.4e-18 3 100 .. 11 124 .. 9 136 .. 0.77 2 ! 46.7 3.9 6.3e-16 3.5e-12 307 366 .. 140 198 .. 129 199 .. 0.89 Alignments for each domain: == domain 1 score: 67.8 bits; conditional E-value: 2.5e-22 DUF445 3 aAliGaladwfAikaLFRhP.....lg.lpiPfttglIPknkeriakklgnfVeehLLtkeslakkLkeaevasklaewlk.. 77 + iG +++w Aik+LFR P +g ++i glIPk++ +i+ ++++V+++L++ + +++ ++++e++++l++++ 23726_FusoPortal_Gene_1148 11 SGAIGWITNWVAIKMLFR-PhreinFGlFKIQ---GLIPKRRAEIGTGIAKIVQNELISVKDVISNIDREEFSKRLNKLIDev 89 578***************.******8888***...*********************************************966 PP DUF445 78 .nptnkesl...........aaiveellkeiledl 100 n++ k+++ +++v++ + ++++ + 23726_FusoPortal_Gene_1148 90 lNKNLKRKVkekfpllqvffTDKVAKDIGNAIKGI 124 64444444433334455444444444444444444 PP == domain 2 score: 46.7 bits; conditional E-value: 6.3e-16 DUF445 307 lekyrldiskiveetvnafdaeeleelIelivgkeLqaIrinGtlvGgliGlllylvsll 366 +e+ + d + i+++++ +f+ ++lee+I l ++keL+ I + G+++G +iG ++yl++l+ 23726_FusoPortal_Gene_1148 140 AEE-NIDFEIIISDKISNFSLDKLEEIITLLAKKELKHIEVIGAVLGMIIGAVQYLITLI 198 444.578899***********************************************988 PP >> DUF5095 Domain of unknown function (DUF5095) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 15.3 6.9 2e-06 0.011 80 163 .. 96 177 .. 54 181 .. 0.80 Alignments for each domain: == domain 1 score: 15.3 bits; conditional E-value: 2e-06 DUF5095 80 eltkksvkyYkfPfthelkkeksdiyksiyveflsalkslFkeykkaneeFyvkykdellifstelkvskklkklLesneief 162 +k++ ++ ++ ft ++ k+ +++k i +e ++ + ++F++y ++n F + ++d++ +fs l + ++++ lL++ e ++ 23726_FusoPortal_Gene_1148 96 RKVKEKFPLLQVFFTDKVAKDIGNAIKGIIMENKEKIFEIFSNYAEENIDFEIIISDKISNFS--LDKLEEIITLLAKKELKH 176 4567788899999*************************************************6..445566666666666655 PP DUF5095 163 v 163 + 23726_FusoPortal_Gene_1148 177 I 177 4 PP >> SRI SRI (Set2 Rpb1 interacting) domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 8.9 2.3 0.00027 1.5 13 70 .. 56 119 .. 53 134 .. 0.76 2 ? 0.4 0.2 0.12 6.8e+02 38 50 .. 164 176 .. 129 182 .. 0.83 Alignments for each domain: == domain 1 score: 8.9 bits; conditional E-value: 0.00027 SRI 13 akvVvnvlnkYrkklk...kedfKklakeltkklvekElkkdksr.dppkel..seekkkkike 70 ak+V n l + ++ ++ +e+f k+ +l +++k lk++ ++ p+ ++ ++++ k i + 23726_FusoPortal_Gene_1148 56 AKIVQNELISVKDVISnidREEFSKRLNKLIDEVLNKNLKRKVKEkFPLLQVffTDKVAKDIGN 119 6677777777777644555**********************76433444455789998888765 PP == domain 2 score: 0.4 bits; conditional E-value: 0.12 SRI 38 eltkklvekElkk 50 e+ l++kElk+ 23726_FusoPortal_Gene_1148 164 EIITLLAKKELKH 176 5667889999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (201 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 1503 (0.0899354); expected 334.2 (0.02) Passed bias filter: 730 (0.0436812); expected 334.2 (0.02) Passed Vit filter: 62 (0.00370991); expected 16.7 (0.001) Passed Fwd filter: 3 (0.000179512); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 3 [number of targets reported over threshold] # CPU time: 0.26u 0.24s 00:00:00.50 Elapsed: 00:00:00.31 # Mc/sec: 1884.88 // [ok]