# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_120.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_120 [L=123] Description: # 139365 # 139733 # -1 # ID=1_120;partial=00;start_type=ATG;rbs_motif=GGAGG;rbs_spacer=5-10bp;gc_cont=0.304 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-31 108.3 10.6 2.7e-31 108.1 10.6 1.0 1 Asp23 Asp23 family, cell envelope-related function ------ inclusion threshold ------ 0.017 15.0 0.1 0.023 14.6 0.1 1.2 1 DUF2420 Protein of unknown function (DUF2420) 0.15 12.2 3.1 0.15 12.1 0.5 2.3 2 FeS_assembly_P Iron-sulfur cluster assembly protein Domain annotation for each model (and alignments): >> Asp23 Asp23 family, cell envelope-related function # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 108.1 10.6 4.8e-35 2.7e-31 2 108 .] 4 109 .. 3 109 .. 0.98 Alignments for each domain: == domain 1 score: 108.1 bits; conditional E-value: 4.8e-35 Asp23 2 lgeieisdeViakiagiaaeeveGvvgmagklkdglaellgkenltkgvkvevgeekqvavdlyvvveYGvkipevaenvqekV 85 lg+i+i+d+V+++ia+ aa++veGv+++ag++ d+++++lgk+++t+gvkvevg e ++++++y++++YG+ki+evae+vq+++ 23726_FusoPortal_Gene_120 4 LGNIRIADDVVKTIAAKAAADVEGVYKLAGGVVDEVSKMLGKKRPTNGVKVEVG-EVECSIEVYLIIKYGYKIAEVAEEVQKAI 86 699***************************************************.789************************** PP Asp23 86 keaveemtglevseVnvhVqgvk 108 eav+++ gl+v+eVnv+Vq+vk 23726_FusoPortal_Gene_120 87 LEAVSSLSGLKVVEVNVYVQNVK 109 *********************96 PP >> DUF2420 Protein of unknown function (DUF2420) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.6 0.1 4.1e-06 0.023 34 66 .. 83 116 .. 71 122 .. 0.83 Alignments for each domain: == domain 1 score: 14.6 bits; conditional E-value: 4.1e-06 DUF2420 34 ekElvLeipeL.dltltEdnvynkdislndilsi 66 +k ++ + +L +l+++E nvy ++++++di ++ 23726_FusoPortal_Gene_120 83 QKAILEAVSSLsGLKVVEVNVYVQNVKMEDIEET 116 555666789999*******************876 PP >> FeS_assembly_P Iron-sulfur cluster assembly protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.2 0.2 0.19 1e+03 58 61 .. 18 21 .. 4 56 .. 0.64 2 ? 12.1 0.5 2.7e-05 0.15 35 74 .] 64 103 .. 49 103 .. 0.89 Alignments for each domain: == domain 1 score: -0.2 bits; conditional E-value: 0.19 HHHH CS FeS_assembly_P 58 eaal 61 a++ 23726_FusoPortal_Gene_120 18 AAKA 21 2222 PP == domain 2 score: 12.1 bits; conditional E-value: 2.7e-05 EEEEEE--SSTT-TTHHHHHHHHHHHHC.STT--EEEEEE CS FeS_assembly_P 35 kVsvditltypacslaeairadaeaalralpgvevveVev 74 +V++ i +y +ae++++++ +a+ +l g +vveV+v 23726_FusoPortal_Gene_120 64 EVYLIIKYGYKIAEVAEEVQKAILEAVSSLSGLKVVEVNV 103 578888888888889***********************97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (123 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 808 (0.0483485); expected 334.2 (0.02) Passed bias filter: 402 (0.0240546); expected 334.2 (0.02) Passed Vit filter: 32 (0.00191479); expected 16.7 (0.001) Passed Fwd filter: 3 (0.000179512); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 3 [number of targets reported over threshold] # CPU time: 0.23u 0.25s 00:00:00.48 Elapsed: 00:00:00.32 # Mc/sec: 1117.39 // [ok]