# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_1290.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_1290 [L=199] Description: # 1406864 # 1407460 # -1 # ID=1_1290;partial=00;start_type=ATG;rbs_motif=GGAGG;rbs_spacer=5-10bp;gc_cont=0.258 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-60 202.7 15.3 4e-60 202.5 15.3 1.0 1 Lys_export Lysine exporter LysO ------ inclusion threshold ------ 3.3 8.1 5.8 14 6.1 0.2 2.7 3 DUF4231 Protein of unknown function (DUF4231) Domain annotation for each model (and alignments): >> Lys_export Lysine exporter LysO # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 202.5 15.3 4.8e-64 4e-60 2 189 .. 6 192 .. 5 193 .. 0.98 Alignments for each domain: == domain 1 score: 202.5 bits; conditional E-value: 4.8e-64 Lys_export 2 laliaGillGllllleaelleeelseylLylLlflvGislgsskelleklkklnlkllllplatilgsllggllaalllglsl 84 +a+i+GillG+++++ ++ + l+++ LylLlf++Gi++g+++++l+ lkkln+k+l+lp++ti++sl+gg++a++ll+ls+ 23726_FusoPortal_Gene_1290 6 CAVIVGILLGYFTKSYINFDISLLIQFGLYLLLFFIGIDIGKNDNILNDLKKLNKKVLFLPFITIIASLAGGAVASILLSLSM 88 589**************99999************************************************************* PP Lys_export 85 keslavasGfGwYSLsgilitelkgaelGtiallanllREllalllipllakrfgklaaislaGatsmDttLPiitkssgkev 167 es+a+++G+GwYS+s+i +++ + elG ia+l+n++RElla++lip++ak++g+++++s+aGat+mD++LPii+ks +e+ 23726_FusoPortal_Gene_1290 89 GESVAISAGMGWYSFSAIELSK-VSVELGGIAFLSNIFRELLAIFLIPIIAKKIGSFESVSVAGATAMDSVLPIINKSNPAEI 170 ********************99.79********************************************************** PP Lys_export 168 vvlaivhGvilsllvPilvslf 189 ++++++G+++s++vPil++++ 23726_FusoPortal_Gene_1290 171 SIISFYTGLVISIVVPILIPIL 192 *******************986 PP >> DUF4231 Protein of unknown function (DUF4231) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 6.1 0.2 0.0017 14 36 71 .. 34 90 .. 1 93 [. 0.69 2 ? -2.2 0.1 0.63 5.3e+03 29 47 .. 132 149 .. 124 174 .. 0.58 3 ? 4.5 0.3 0.0053 45 10 36 .. 168 194 .. 161 197 .. 0.89 Alignments for each domain: == domain 1 score: 6.1 bits; conditional E-value: 0.0017 DUF4231 36 s.....................sklgagvsvlkiltallsalvailaaleeffryke 71 +kl+ +v +l+++t ++s++ +a++ ++e 23726_FusoPortal_Gene_1290 34 LylllffigidigkndnilndlKKLNKKVLFLPFITIIASLAGGAVASILLSLSMGE 90 033333334444577777777888999999*****************9999888887 PP == domain 2 score: -2.2 bits; conditional E-value: 0.63 DUF4231 29 allpilvssklgagvsvlk 47 +l+pi++ k g+ sv 23726_FusoPortal_Gene_1290 132 FLIPIIAK-KIGSFESVSV 149 66777776.2222222222 PP == domain 3 score: 4.5 bits; conditional E-value: 0.0053 DUF4231 10 asrakrrfrllrlitivlgallpilvs 36 a+++ +f++ +i+iv+ +l+pilv+ 23726_FusoPortal_Gene_1290 168 AEISIISFYTGLVISIVVPILIPILVN 194 778889999999************997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (199 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 797 (0.0476903); expected 334.2 (0.02) Passed bias filter: 344 (0.020584); expected 334.2 (0.02) Passed Vit filter: 35 (0.0020943); expected 16.7 (0.001) Passed Fwd filter: 4 (0.000239349); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.24u 0.24s 00:00:00.48 Elapsed: 00:00:00.31 # Mc/sec: 1866.13 // [ok]