# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_1314.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_1314 [L=185] Description: # 1428477 # 1429031 # 1 # ID=1_1314;partial=00;start_type=ATG;rbs_motif=AGGAG;rbs_spacer=5-10bp;gc_cont=0.222 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- ------ inclusion threshold ------ 0.21 11.4 6.7 8.7 6.1 0.4 3.1 3 DUF2227 Uncharacterized metal-binding protein (DUF2227) 0.3 11.0 8.4 0.4 10.6 6.8 2.1 1 NdhL NADH dehydrogenase transmembrane subunit Domain annotation for each model (and alignments): >> DUF2227 Uncharacterized metal-binding protein (DUF2227) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 6.1 0.4 0.001 8.7 71 93 .. 30 52 .. 16 62 .. 0.84 2 ? 3.7 0.0 0.0057 48 141 166 .. 59 84 .. 49 86 .. 0.79 3 ? 4.4 0.3 0.0033 28 78 116 .. 107 145 .. 104 175 .. 0.81 Alignments for each domain: == domain 1 score: 6.1 bits; conditional E-value: 0.001 DUF2227 71 kllrHRsllSHglivGtllRllY 93 lrHR +l+H++ + ++ lY 23726_FusoPortal_Gene_1314 30 LGLRHRNILTHSPFITIIFIALY 52 5689*********9988776666 PP == domain 2 score: 3.7 bits; conditional E-value: 0.0057 DUF2227 141 ellalllGlelgamlHllsDwvvsal 166 + +++G+ ++ ++H+l D + ++ 23726_FusoPortal_Gene_1314 59 FFKYFIVGFSTATAIHILFDLFPRKW 84 556789**************987765 PP == domain 3 score: 4.4 bits; conditional E-value: 0.0033 DUF2227 78 llSHglivGtllRllYllllllllllllallllavleln 116 +++ +++++t l ++Y++ + ++l+ +l+++ + + 23726_FusoPortal_Gene_1314 107 FFTITVLISTFLGIFYMTEIQEYYFVLFYAILTFIKKRK 145 5677899*************8888888888877777654 PP >> NdhL NADH dehydrogenase transmembrane subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 10.6 6.8 4.8e-05 0.4 21 58 .. 127 164 .. 108 167 .. 0.83 Alignments for each domain: == domain 1 score: 10.6 bits; conditional E-value: 4.8e-05 NdhL 21 vlYllviPlilylwlrkRWyvaskiErlliymlvflfF 58 Y +v+ +++++++kR y+ s+i ++i+ +++lf 23726_FusoPortal_Gene_1314 127 QEYYFVLFYAILTFIKKRKYENSFIKPAFIFAFLYLFL 164 35778888999*************************95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (185 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 744 (0.0445189); expected 334.2 (0.02) Passed bias filter: 233 (0.0139421); expected 334.2 (0.02) Passed Vit filter: 22 (0.00131642); expected 16.7 (0.001) Passed Fwd filter: 2 (0.000119674); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.25u 0.24s 00:00:00.49 Elapsed: 00:00:00.33 # Mc/sec: 1629.70 // [ok]