# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_135.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_135 [L=123] Description: # 148293 # 148661 # -1 # ID=1_135;partial=00;start_type=ATG;rbs_motif=AGGAGG;rbs_spacer=5-10bp;gc_cont=0.325 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-53 178.4 3.8 4.9e-53 178.3 3.8 1.0 1 Ribosomal_L14 Ribosomal protein L14p/L23e Domain annotation for each model (and alignments): >> Ribosomal_L14 Ribosomal protein L14p/L23e # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 178.3 3.8 2.9e-57 4.9e-53 1 122 [] 1 122 [. 1 122 [. 0.99 Alignments for each domain: == domain 1 score: 178.3 bits; conditional E-value: 2.9e-57 ..CSS-EEE--SSSSBSEEEEEEETT-.---EE-SSSEEEEEESSS-T...TTSSCEEEEEEEE-SS-EE-TTS-EEEESS-EE CS Ribosomal_L14 1 miqlktrlkvaDNsgakevecikvlggkkrkaasvGdiivvsvkkakpkgkvkkgdvvkavvvrtkkevrrkdGsvirfddnaa 84 m+q++t+l+vaDNsgak++++i+vlgg++++++++Gdi+v+svk+a+p g+vkkgd+vkav+vrt+ke+rr dGs+i+fddna 23726_FusoPortal_Gene_135 1 MVQQQTILNVADNSGAKKLMVIRVLGGSRKRFGKIGDIVVASVKEAIPGGNVKKGDIVKAVIVRTRKETRRDDGSYIKFDDNAG 84 9*********************************************************************************** PP EEB-TTS-BSS-.B-SBEEHHHHHH.-HHHHHTBSBE. CS Ribosomal_L14 85 VlinkkgeplGtrifgpvarelrekkflkivslApevl 122 V+in+++ep+ trifgpvarelr ++f+ki+slA ev+ 23726_FusoPortal_Gene_135 85 VVINNNNEPRATRIFGPVARELRARNFMKILSLAIEVI 122 **********************************9996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (123 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 398 (0.0238152); expected 334.2 (0.02) Passed bias filter: 318 (0.0190282); expected 334.2 (0.02) Passed Vit filter: 25 (0.00149593); expected 16.7 (0.001) Passed Fwd filter: 1 (5.98372e-05); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.23u 0.25s 00:00:00.48 Elapsed: 00:00:00.34 # Mc/sec: 1051.66 // [ok]