# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_1419.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_1419 [L=241] Description: # 1523447 # 1524169 # 1 # ID=1_1419;partial=00;start_type=ATG;rbs_motif=AGGAG;rbs_spacer=5-10bp;gc_cont=0.261 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-47 161.4 0.0 3e-47 161.2 0.0 1.0 1 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases Domain annotation for each model (and alignments): >> TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 161.2 0.0 1.8e-51 3e-47 1 205 [. 4 208 .. 4 215 .. 0.94 Alignments for each domain: == domain 1 score: 161.2 bits; conditional E-value: 1.8e-51 TP_methylase 1 klylVGvGpGdpellTvrAlralktadvvlgddsr......aleilldllaeel...eleapmgkekepleqayeeiaealae 74 k+y++GvG Gdpe +T++A+++lk+ dvv+ ++++ a+ei++++++e+ ++e+pm k+ e++e a +e+a+++ + 23726_FusoPortal_Gene_1419 4 KFYGIGVGVGDPEEITLKAVNTLKKLDVVILPEAKkdegsvAYEIAKEYMKEDVervFVEFPMLKSLEDRENARKENAKIVQK 86 79***************************888844566789****************************************** PP TP_methylase 75 alragkdVallvsGDPlvygtgselvealrareagievevvPGvsslqaaaarlgiplteggevlsvllpglakeerreleal 157 +l++gk+V +l++GD + y+t+ +++e+l +++ ve++PG+ss+ +a+r+++pl g+e+l v+ +l ++++ +e 23726_FusoPortal_Gene_1419 87 LLDEGKNVGFLTIGDTMTYSTYVYILEHLPEKYL---VETIPGISSFVDMASRFNFPLMIGDETLKVV--PL--NKKTNIEFE 162 *******************************665...*******************************..44..489999999 PP TP_methylase 158 langdtvvllkaprklaelaelLkealpddttpvavveragtedervv 205 l+n+d++v++k r++++l+++L++ + + ++++v+++g+e+++v+ 23726_FusoPortal_Gene_1419 163 LENNDNIVFMKVSRNFENLKQALIKT-ENID-RIIMVSNCGKENQKVY 208 9*************************.6655.***************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (241 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 903 (0.054033); expected 334.2 (0.02) Passed bias filter: 475 (0.0284227); expected 334.2 (0.02) Passed Vit filter: 34 (0.00203447); expected 16.7 (0.001) Passed Fwd filter: 1 (5.98372e-05); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.37u 0.35s 00:00:00.72 Elapsed: 00:00:00.46 # Mc/sec: 1523.03 // [ok]