# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_1487.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_1487 [L=179] Description: # 1585554 # 1586090 # -1 # ID=1_1487;partial=00;start_type=ATG;rbs_motif=GGAG/GAGG;rbs_spacer=5-10bp;gc_cont=0.197 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-06 25.6 0.7 1.4e-05 24.3 0.7 1.7 1 YcxB YcxB-like protein 0.0029 17.2 2.2 0.0039 16.7 2.2 1.4 1 Wzy_C O-Antigen ligase ------ inclusion threshold ------ 0.025 14.9 0.3 0.045 14.1 0.3 1.4 1 POB3_N POB3-like N-terminal PH domain 0.098 13.0 0.8 0.14 12.4 0.8 1.2 1 DUF3329 Domain of unknown function (DUF3329) Domain annotation for each model (and alignments): >> YcxB YcxB-like protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 24.3 0.7 3.4e-09 1.4e-05 5 62 .] 102 159 .. 100 159 .. 0.97 Alignments for each domain: == domain 1 score: 24.3 bits; conditional E-value: 3.4e-09 YcxB 5 GivvrtgegtstikWkdikkvyetkdfillylskqqafiiPKrafseeefeefraflk 62 i +++g+ ++++ ++ i k+y k ++l++ + +++++ ++f+++ fe+f++f+k 23726_FusoPortal_Gene_1487 102 NIFMQEGKFSMELDYSKIVKIYYLKYSYVLMFTNSNGIMVKYDSFTKGNFEDFKEFIK 159 689999**************************************************97 PP >> Wzy_C O-Antigen ligase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.7 2.2 9.4e-07 0.0039 10 80 .. 23 112 .. 20 173 .. 0.67 Alignments for each domain: == domain 1 score: 16.7 bits; conditional E-value: 9.4e-07 Wzy_C 10 lflstsRsgiigllvalivlliifykrripfllllgilvgvilliilfvlstnletlknitkafgkldkk............. 79 +++ +sR+ i+ +++++ +li ++ r + ++ +i+++vill+ f+ ++ l++l ++t ++d++ 23726_FusoPortal_Gene_1487 23 ILAKNSRGIILLYILIFLSILINWILRGNLSEIYWMIACIVILLLFNFYNQKYLFRLLKRTDRSIHNDQSyptlvqfgnnifm 105 57889***888874444444444433333345555556668888888888889998888888888888777777766666655 PP Wzy_C 80 ......k 80 + 23726_FusoPortal_Gene_1487 106 qegkfsM 112 5444441 PP >> POB3_N POB3-like N-terminal PH domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.1 0.3 1.1e-05 0.045 41 88 .. 118 163 .. 101 167 .. 0.79 Alignments for each domain: == domain 1 score: 14.1 bits; conditional E-value: 1.1e-05 POB3_N 41 dissaqWvrvargyqLrillkdgkvvrfdGFkeedfdkLskllkknfn 88 i ++ +++ +y L ++ +g +v++d F++ +f++ ++++k+n + 23726_FusoPortal_Gene_1487 118 KIVKIYYLK--YSYVLMFTNSNGIMVKYDSFTKGNFEDFKEFIKENCK 163 444444443..4688888889************************986 PP >> DUF3329 Domain of unknown function (DUF3329) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.4 0.8 3.4e-05 0.14 7 57 .. 33 85 .. 27 92 .. 0.63 Alignments for each domain: == domain 1 score: 12.4 bits; conditional E-value: 3.4e-05 DUF3329 7 lrlallllaallvgllvgalaalll..lgllallawhlyqllrLsrWLrapkk 57 l+ +l++l++l+ ++l g+l+ + + +++ll++++y+++ L r L++ ++ 23726_FusoPortal_Gene_1487 33 LLYILIFLSILINWILRGNLSEIYWmiACIVILLLFNFYNQKYLFRLLKRTDR 85 34444555554566666777654444466777788888888888888877665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (179 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 1102 (0.0659406); expected 334.2 (0.02) Passed bias filter: 435 (0.0260292); expected 334.2 (0.02) Passed Vit filter: 47 (0.00281235); expected 16.7 (0.001) Passed Fwd filter: 4 (0.000239349); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 4 [number of targets reported over threshold] # CPU time: 0.28u 0.23s 00:00:00.51 Elapsed: 00:00:00.35 # Mc/sec: 1486.74 // [ok]