# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_1499.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_1499 [L=263] Description: # 1597670 # 1598458 # 1 # ID=1_1499;partial=00;start_type=GTG;rbs_motif=AGGAGG;rbs_spacer=5-10bp;gc_cont=0.247 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-74 248.1 30.8 9.7e-74 247.9 30.8 1.0 1 ABC2_membrane_6 ABC-2 family transporter protein Domain annotation for each model (and alignments): >> ABC2_membrane_6 ABC-2 family transporter protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 247.9 30.8 5.8e-78 9.7e-74 1 229 [] 34 261 .. 34 261 .. 1.00 Alignments for each domain: == domain 1 score: 247.9 bits; conditional E-value: 5.8e-78 ABC2_membrane_6 1 lillalsllllslifskvgslgGwnleevllllglflilqglaavffapalsrigesvrdGsldflLlkPinlllqillkrln 83 li+++++++++++ f+++++++Gwn +++l+l+++ ++++++++++ p+l+r++e +++G+ldflLlkP+n++++i++++++ 23726_FusoPortal_Gene_1499 34 LIWMVMYIIFINVAFLHTKDINGWNKYQMLMLTFQGGLMDSVFTFAVVPGLKRLPELINKGTLDFLLLKPVNKKFNISFNEFD 116 79********************************************************************************* PP ABC2_membrane_6 84 lrrvgrllvgiilliyavkkldikltaakillliislilglliltslffilgslsfwfvkseeiieileglleaakyPltiyp 166 ++++++++++i+ +iy++kkl+i+lt++kil++i++ i+g+l+++s++f+l+sl+fwf++++ ++ i ++l++++++P++iyp 23726_FusoPortal_Gene_1499 117 IPQIKNIFINIFGIIYCIKKLQIVLTPTKILIYILLSINGFLMIYSIMFMLMSLAFWFMRMDIVMGIGSELITVGNKPMSIYP 199 *********************************************************************************** PP ABC2_membrane_6 167 lilrklltfiiPvaflsyvPaeivlgklsivfalvlqlilalvllvlskliwkkglrkYtsaG 229 +i++k+l+fiiP+++++++P+ ++++ l+++f++++ +i+++++++++++i+k+glr+Y+saG 23726_FusoPortal_Gene_1499 200 NIIQKILIFIIPLFVCFNFPILYIVKGLNLYFIIYS-FIATAICFMVLNFIFKRGLRRYVSAG 261 ************************************.************************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (263 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 1048 (0.0627094); expected 334.2 (0.02) Passed bias filter: 253 (0.0151388); expected 334.2 (0.02) Passed Vit filter: 17 (0.00101723); expected 16.7 (0.001) Passed Fwd filter: 3 (0.000179512); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.26u 0.23s 00:00:00.49 Elapsed: 00:00:00.32 # Mc/sec: 2389.22 // [ok]