# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_151.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_151 [L=304] Description: # 156974 # 157885 # -1 # ID=1_151;partial=00;start_type=ATG;rbs_motif=GGAGG;rbs_spacer=3-4bp;gc_cont=0.246 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-23 83.5 17.4 1.4e-23 83.5 17.4 2.0 2 BPD_transp_1 Binding-protein-dependent transport system inne Domain annotation for each model (and alignments): >> BPD_transp_1 Binding-protein-dependent transport system inner membrane component # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.4 0.8 0.09 1.5e+03 53 63 .. 12 23 .. 3 42 .. 0.45 2 ! 83.5 17.4 8.2e-28 1.4e-23 2 179 .. 112 297 .. 111 300 .. 0.94 Alignments for each domain: == domain 1 score: -1.4 bits; conditional E-value: 0.09 BPD_transp_1 53 ilp.viilllls 63 ++ vi+ l++ 23726_FusoPortal_Gene_151 12 FILsVITFLIVR 23 111122222222 PP == domain 2 score: 83.5 bits; conditional E-value: 8.2e-28 BPD_transp_1 2 illGilaalnrnkkldkllrpliivllslPsfvlaillvlvf........vilsilghlilp.viillllsaapyvrlirraal 76 ++lG+laa + ++++dk+ r+++i++ls+Psf++ai++++ f +++++ ++il +iil+l++ + + r++r ++ 23726_FusoPortal_Gene_151 112 FFLGYLAAIKEKGFFDKMTRTISILTLSIPSFIIAIFIIYYFgvktqlikFFIGGKFYGILFsIIILVLYQVGNLSRIVRDTFV 195 689***********************************************7777777888887999999999999999999*** PP BPD_transp_1 77 rslpkdlveaaralGasrwqifrkvvlPnalppiitglilafggllggavlleflgswpGlgtllleailgydyseisnggvla 160 + ++ +v++++++G + ++ ++ ++ al ++++ i f +++gg++++ef ++ pG++++l+++i ++dy+ i+ ++++ 23726_FusoPortal_Gene_151 196 EMKEETFVKFYLIRGFNINYVLLRHCYKPALYSLFSASISKFSSVVGGSAVVEFSFAIPGISYFLISSIVNRDYNVIQ-AYIFL 278 ******************************************************************************.88888 PP BPD_transp_1 161 lviavlllnlvadilqrll 179 + i+++ + l++d+l +l 23726_FusoPortal_Gene_151 279 ICIYMFFVHLIFDFLLSFL 297 8888888889999987665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (304 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 943 (0.0564265); expected 334.2 (0.02) Passed bias filter: 308 (0.0184299); expected 334.2 (0.02) Passed Vit filter: 27 (0.00161561); expected 16.7 (0.001) Passed Fwd filter: 6 (0.000359023); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.29u 0.23s 00:00:00.52 Elapsed: 00:00:00.32 # Mc/sec: 2761.68 // [ok]