# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_1531.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_1531 [L=197] Description: # 1632441 # 1633031 # -1 # ID=1_1531;partial=00;start_type=ATG;rbs_motif=GGA/GAG/AGG;rbs_spacer=5-10bp;gc_cont=0.222 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-09 37.2 0.1 3.6e-09 36.4 0.1 1.3 1 DUF452 Protein of unknown function (DUF452) Domain annotation for each model (and alignments): >> DUF452 Protein of unknown function (DUF452) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.4 0.1 2.1e-13 3.6e-09 14 210 .. 4 190 .. 2 193 .. 0.78 Alignments for each domain: == domain 1 score: 36.4 bits; conditional E-value: 2.1e-13 DUF452 14 ilyfagwgtppdvvehlilpenydlllcydyrdlnldvdfsayrhirlvawsmgvwvaervlqg.irlksatavngtglpcd. 94 i +f gwg + + + +yd+ + d +d df + + +s+gv+ ++ l lk a+ glp 23726_FusoPortal_Gene_1531 4 IYFFNGWGMDENLLIPIKNSTDYDIEVINFPYD--IDKDFID-KDDSFIGYSFGVYYLNKFLSEnKDLKYKKAIGINGLPQTi 83 7799*****999999888899999866543334..5666754.556789********99999751568889999999999653 PP DUF452 95 dqygipeavfkgtlenltedtrlkferricgdkalledyqqysarptlqeihaelialyallqqdrrtdlirwskalvgskdk 177 ++gi e +f+ tl++l+e++ kf + d + + s + +++ei++el +++++ r + +g +d+ 23726_FusoPortal_Gene_1531 84 GKFGINEKMFNITLDTLNEENLEKFLINMDIDDSFCK-----SNK-SFDEIKNELQ----FFKNNYRIIDNHIDFYYIGKNDR 156 79***********************999877665554.....344.4899999986....344444443344455689***** PP DUF452 178 ifmaanqraywtdrc.avreidvehllfsrfthw 210 i++a+ ++y ++ a + ++ +h+ fs f + 23726_FusoPortal_Gene_1531 157 IIPANRLEKYCQNHSlAYKLLEYGHYPFSYFKDF 190 **********998762678899*******99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (197 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 718 (0.0429631); expected 334.2 (0.02) Passed bias filter: 374 (0.0223791); expected 334.2 (0.02) Passed Vit filter: 27 (0.00161561); expected 16.7 (0.001) Passed Fwd filter: 1 (5.98372e-05); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.23u 0.24s 00:00:00.47 Elapsed: 00:00:00.31 # Mc/sec: 1847.37 // [ok]