# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_157.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_157 [L=73] Description: # 165808 # 166026 # -1 # ID=1_157;partial=00;start_type=ATG;rbs_motif=AGGAGG;rbs_spacer=5-10bp;gc_cont=0.279 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-24 84.5 0.4 4.9e-24 84.2 0.4 1.1 1 Ribosomal_S18 Ribosomal protein S18 ------ inclusion threshold ------ 0.094 12.7 0.6 0.15 12.1 0.2 1.5 2 Cro Cro Domain annotation for each model (and alignments): >> Ribosomal_S18 Ribosomal protein S18 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 84.2 0.4 5.9e-28 4.9e-24 1 52 [] 14 65 .. 14 65 .. 0.97 Alignments for each domain: == domain 1 score: 84.2 bits; conditional E-value: 5.9e-28 Ribosomal_S18 1 kkekidYkdvelLsqFiterGkIlprriTglcakhQrklakaIkrARhlaLL 52 k+e+idYk+velL++F++++GkI p+r Tg ak Qrk+aka+krAR++aL+ 23726_FusoPortal_Gene_157 14 KAEEIDYKNVELLKRFVSDKGKINPSRLTGANAKLQRKIAKAVKRARNIALI 65 5799**********************************************96 PP >> Cro Cro # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.0 0.89 7.4e+03 49 54 .. 13 18 .. 8 18 .. 0.77 2 ? 12.1 0.2 1.7e-05 0.15 5 42 .. 25 65 .. 21 69 .. 0.81 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.89 EEEEEE CS Cro 49 veaeEv 54 v+aeE+ 23726_FusoPortal_Gene_157 13 VKAEEI 18 788886 PP == domain 2 score: 12.1 bits; conditional E-value: 1.7e-05 EHHHHHHHHHHHHHHHHHTS-...HHHHHHHHHCT-EEEEE CS Cro 5 sLsdyvtkvGQaktAkdlgvk...qsaIsKAlkakRnIyli 42 L+ +v G + g + q I+KA+k RnI li 23726_FusoPortal_Gene_157 25 LLKRFVSDKGKINPSRLTGANaklQRKIAKAVKRARNIALI 65 578888888888888888875445899***********987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (73 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 619 (0.0370393); expected 334.2 (0.02) Passed bias filter: 358 (0.0214217); expected 334.2 (0.02) Passed Vit filter: 27 (0.00161561); expected 16.7 (0.001) Passed Fwd filter: 2 (0.000119674); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.22u 0.24s 00:00:00.46 Elapsed: 00:00:00.33 # Mc/sec: 643.07 // [ok]