# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_1680.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_1680 [L=226] Description: # 1800263 # 1800940 # -1 # ID=1_1680;partial=00;start_type=ATG;rbs_motif=GGAGG;rbs_spacer=5-10bp;gc_cont=0.208 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- ------ inclusion threshold ------ 0.028 13.9 5.3 0.044 13.2 5.3 1.3 1 MscS_porin Mechanosensitive ion channel porin domain 0.074 13.2 7.9 0.18 12.0 6.8 2.2 2 TMF_TATA_bd TATA element modulatory factor 1 TATA binding 0.18 11.6 2.1 0.29 11.0 2.1 1.3 1 DUF1635 Protein of unknown function (DUF1635) 0.29 10.9 10.4 0.13 12.1 7.2 2.2 2 PKcGMP_CC Coiled-coil N-terminus of cGMP-dependent protein 10 6.0 19.1 13 5.6 15.8 2.1 2 OmpH Outer membrane protein (OmpH-like) Domain annotation for each model (and alignments): >> MscS_porin Mechanosensitive ion channel porin domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 13.2 5.3 1.3e-05 0.044 35 119 .. 8 88 .. 7 92 .. 0.87 Alignments for each domain: == domain 1 score: 13.2 bits; conditional E-value: 1.3e-05 MscS_porin 35 skkkaeelqkqiddaPkelrelrqelealqkkkeeaskedlaklsleeLeqrllqtssqlqelqeqlaqlnsqlrelqtrper 117 +k+k e++ kqi+d +++l++ ++e+ +l+ + e ++e+++++s ++Le + +l ++ e ++++++l++++ pe+ 23726_FusoPortal_Gene_1680 8 FKEKEEKYLKQIEDLQNKLKKKEEEILQLKYDLEVVTQERDNRISGKQLEIF----ERNLKQNVESSKKYKDLLISYRINPEK 86 58999*******************************************9975....556666666777888888888888888 PP MscS_porin 118 aq 119 +q 23726_FusoPortal_Gene_1680 87 IQ 88 88 PP >> TMF_TATA_bd TATA element modulatory factor 1 TATA binding # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.0 6.8 5.3e-05 0.18 10 57 .. 15 63 .. 9 115 .. 0.69 2 ? -0.7 0.0 0.44 1.5e+03 44 71 .. 151 178 .. 128 218 .. 0.69 Alignments for each domain: == domain 1 score: 12.0 bits; conditional E-value: 5.3e-05 TMF_TATA_bd 10 svqlverlsseirrlEgElaslkeelerleaerdea.reeivklmeene 57 + +e l+ +++++E E+ +lk +le +++erd+ + +++ e+n 23726_FusoPortal_Gene_1680 15 YLKQIEDLQNKLKKKEEEILQLKYDLEVVTQERDNRiSGKQLEIFERNL 63 56779****************************9742444444444433 PP == domain 2 score: -0.7 bits; conditional E-value: 0.44 TMF_TATA_bd 44 eareeivklmeeneelkelkkeleelek 71 + ei++ +++ e+ ++ +++++l + 23726_FusoPortal_Gene_1680 151 RFDWEIATFINRGEKISKIYSKSKKLVT 178 4556777888888887777777777766 PP >> DUF1635 Protein of unknown function (DUF1635) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.0 2.1 8.7e-05 0.29 24 68 .. 22 65 .. 15 94 .. 0.78 Alignments for each domain: == domain 1 score: 11.0 bits; conditional E-value: 8.7e-05 DUF1635 24 aqeelrkreeevakLkdllkktikErdeAreklqkllleklllqq 68 q++l+k+eee+ +Lk l+ +++Erd+ q ++e+ l+q 23726_FusoPortal_Gene_1680 22 LQNKLKKKEEEILQLKYDLEVVTQERDNRISGKQLEIFERN-LKQ 65 5899***********************86554444444444.444 PP >> PKcGMP_CC Coiled-coil N-terminus of cGMP-dependent protein kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.1 7.2 3.8e-05 0.13 6 30 .. 11 39 .. 7 42 .. 0.81 2 ? -3.2 0.0 2.2 7.4e+03 15 24 .. 49 58 .. 43 60 .. 0.59 Alignments for each domain: == domain 1 score: 12.1 bits; conditional E-value: 3.8e-05 PKcGMP_CC 6 KDER....IRELEkrlaekdeEIqELrsk 30 K+E+ I +L+++l++k+eEI +L+ 23726_FusoPortal_Gene_1680 11 KEEKylkqIEDLQNKLKKKEEEILQLKYD 39 666555559*****************965 PP == domain 2 score: -3.2 bits; conditional E-value: 2.2 PKcGMP_CC 15 krlaekdeEI 24 +r++ k EI 23726_FusoPortal_Gene_1680 49 NRISGKQLEI 58 5555565555 PP >> OmpH Outer membrane protein (OmpH-like) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 5.6 15.8 0.004 13 42 142 .. 9 119 .. 7 129 .. 0.75 2 ? 3.1 0.2 0.023 78 74 137 .. 117 182 .. 101 194 .. 0.69 Alignments for each domain: == domain 1 score: 5.6 bits; conditional E-value: 0.004 HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTS...-HHHHHHHHHHHHHHHHHHHHHH.HHHHHHHHHHHHH.......HHHH CS OmpH 42 ekefkklqaeleakekelqkkqeelqkkakkle..keekeqelqkkeqelqakqqqkaqqelqkkqqellkp.......ildk 115 +++++k+ +++e ++++l+kk+ee+ + + +le ++e+ + + k+ e+ + ++ k++ e kk ++ll + i+ k 23726_FusoPortal_Gene_1680 9 KEKEEKYLKQIEDLQNKLKKKEEEILQLKYDLEvvTQERDNRISGKQLEIFE-RNLKQNVESSKKYKDLLISyrinpekIQYK 90 556666777777777777777776664444432479999999*******999.999998999999999776333444449999 PP HHHHHHHHHHHTT-SEEEE...GGG-S-- CS OmpH 116 inkaikevakekgydlvld..arsavlya 142 + +k++ + k+++ +l+ ++ ++l++ 23726_FusoPortal_Gene_1680 91 YKVELKNFYSGKKFQEILNifNEKNILFV 119 99999999999999999999966777776 PP == domain 2 score: 3.1 bits; conditional E-value: 0.023 ......-HHHHHHHHHHHHHHHHHHHHHH.HHHHHHHHH.HHHHHHHHHHHHHHHHHHHTT-SEEEE.GG CS OmpH 74 e.....keekeqelqkkeqelqakqqqkaqqelqkkqqe.llkpildkinkaikevakekgydlvldars 137 kee ++++ ++ +++ + ++q++ +++ ++ + +++ ++++ +k+ k + k k++ +++ + 23726_FusoPortal_Gene_1680 117 LfvdylKEEDFNDIPRETKNFDE-AKQRF-LDFKSERFDwEIATFINRGEKISKIYSKSKKLVTIFS--D 182 25666677777788888888888.77777.6777777667888999999999999999999999998..3 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (226 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 1861 (0.111357); expected 334.2 (0.02) Passed bias filter: 495 (0.0296194); expected 334.2 (0.02) Passed Vit filter: 54 (0.00323121); expected 16.7 (0.001) Passed Fwd filter: 6 (0.000359023); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 5 [number of targets reported over threshold] # CPU time: 0.26u 0.23s 00:00:00.49 Elapsed: 00:00:00.31 # Mc/sec: 2119.32 // [ok]