# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_172.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_172 [L=375] Description: # 182589 # 183713 # -1 # ID=1_172;partial=00;start_type=ATG;rbs_motif=AGGAG;rbs_spacer=5-10bp;gc_cont=0.294 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- ------ inclusion threshold ------ 0.016 14.2 0.0 0.025 13.6 0.0 1.3 1 NAD_synthase NAD synthase 0.12 11.5 0.0 0.21 10.7 0.0 1.3 1 DUF4824 Domain of unknown function (DUF4824) Domain annotation for each model (and alignments): >> NAD_synthase NAD synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 13.6 0.0 3e-06 0.025 16 44 .. 57 85 .. 43 132 .. 0.81 Alignments for each domain: == domain 1 score: 13.6 bits; conditional E-value: 3e-06 CTTSEEEEEE-SSHHHHHHHHHHHHHHTC CS NAD_synthase 16 agakgvvlGlSGGvDSslvaalavkalgk 44 +++ v+G+SGG DS++ a a++ lg 23726_FusoPortal_Gene_172 57 KNSYHCVIGVSGGKDSTFQAIYAKEKLGL 85 455679******************99953 PP >> DUF4824 Domain of unknown function (DUF4824) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 10.7 0.0 2.5e-05 0.21 73 116 .. 292 333 .. 268 344 .. 0.72 Alignments for each domain: == domain 1 score: 10.7 bits; conditional E-value: 2.5e-05 DUF4824 73 eLGFaaedaevedaeerykrqlarevllvLEldGpayqqelera 116 +GFa+++a + +e r +r + +lv E+dG+ qq++ + 23726_FusoPortal_Gene_172 292 GFGFATDEACYDIREGRLTR--EEAIWLVNEYDGKCGQQYIDEF 333 25666666555555556655..5889*************99875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (375 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 691 (0.0413475); expected 334.2 (0.02) Passed bias filter: 542 (0.0324318); expected 334.2 (0.02) Passed Vit filter: 46 (0.00275251); expected 16.7 (0.001) Passed Fwd filter: 2 (0.000119674); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.26u 0.22s 00:00:00.48 Elapsed: 00:00:00.30 # Mc/sec: 3633.79 // [ok]