# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_1748.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_1748 [L=377] Description: # 1872751 # 1873881 # 1 # ID=1_1748;partial=00;start_type=ATG;rbs_motif=AGGAG;rbs_spacer=5-10bp;gc_cont=0.218 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-07 31.3 0.0 3.1e-07 30.8 0.0 1.2 1 BTAD Bacterial transcriptional activator domain 0.00094 19.1 0.0 0.0027 17.6 0.0 1.8 1 Trans_reg_C Transcriptional regulatory protein, C terminal 0.006 16.6 1.4 1.2 9.4 0.1 3.0 2 TPR_8 Tetratricopeptide repeat Domain annotation for each model (and alignments): >> BTAD Bacterial transcriptional activator domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.8 0.0 5.5e-11 3.1e-07 32 146 .] 124 244 .. 114 244 .. 0.84 Alignments for each domain: == domain 1 score: 30.8 bits; conditional E-value: 5.5e-11 HHTT--SSTTGGGTT......STTHHHHHHHHHHHHHHHHHHHHHHHHHTT.-HHHHHHHHHHHHHHSTT-HHHHHHHHHHHH CS BTAD 32 AlalwrGpaladlea......gewleaererleelrlealealaeaelrlG.raeealaelealvaehPlrErlhrqlmrAla 107 ++ + G++++++ +e + er ++ee+++++l +l+ + +++ e++ + l++l++ +P++E+ +++ + 23726_FusoPortal_Gene_1748 124 LRKKFSGEFFEGFYFkncndfNESIILERGYFEEQKIKILLKLVS-LYEIEqNFEKCSEILKELINIEPYDEEIALRILEIYE 205 55556666666654445555778888999****************.45555378999999*********************** PP HTT-HHHHHHHHHHHHHHHHHHHS----HHHHHHHHHHH CS BTAD 108 rsGrqaeALevYerlrrlLaeeLgvepgpelralheeil 146 + G+++ A+ Ye++++ + Lg++p++el + + ei+ 23726_FusoPortal_Gene_1748 206 KNGKRSSAILFYEDFKKKFMTFLGIQPSEELEKKYLEIK 244 *******************************99988885 PP >> Trans_reg_C Transcriptional regulatory protein, C terminal # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 17.6 0.0 4.9e-07 0.0027 8 70 .. 25 88 .. 22 91 .. 0.81 Alignments for each domain: == domain 1 score: 17.6 bits; conditional E-value: 4.9e-07 HHHHHHHHHHHHTTTSEEEHHHHHHHHTTTTS.TSHTHHHHHHHHHHHHHHHTTTSSSSSEEEE CS Trans_reg_C 8 pkefklLelLlenpgrvvsreeLleevwgede.dvddrtvdvhisrLRkkLeddekkprlIetv 70 +k +lL lL+ n+++++ re+++ ++w++++ d+ ++ + +L + ++ de+ +++++t 23726_FusoPortal_Gene_1748 25 AKTKALLSLLILNKDKPLNREKIILYLWPDSSeDSGKFNLRFNLWQLKNIIGLDENGNKFLHTG 88 67779*************************9966666678888888887777777666777775 PP >> TPR_8 Tetratricopeptide repeat # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 9.4 0.1 0.00022 1.2 2 32 .. 161 191 .. 160 193 .. 0.92 2 ! 5.2 0.1 0.005 28 5 25 .. 198 218 .. 194 220 .. 0.89 Alignments for each domain: == domain 1 score: 9.4 bits; conditional E-value: 0.00022 CHHHHHHHHHHHTT-HHHHHHHHHHHHHHHH CS TPR_8 2 eayynlgsiylklgdyeeAkeyyekaleldp 32 +++++l s+y+ +++e+ e +++ + ++p 23726_FusoPortal_Gene_1748 161 KILLKLVSLYEIEQNFEKCSEILKELINIEP 191 688999***********************99 PP == domain 2 score: 5.2 bits; conditional E-value: 0.005 HHHHHHHHHTT-HHHHHHHHH CS TPR_8 5 ynlgsiylklgdyeeAkeyye 25 +++ iy+k g+ +A+ +ye 23726_FusoPortal_Gene_1748 198 LRILEIYEKNGKRSSAILFYE 218 68999**************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (377 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 915 (0.0547511); expected 334.2 (0.02) Passed bias filter: 304 (0.0181905); expected 334.2 (0.02) Passed Vit filter: 38 (0.00227382); expected 16.7 (0.001) Passed Fwd filter: 3 (0.000179512); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 3 [number of targets reported over threshold] # CPU time: 0.28u 0.24s 00:00:00.52 Elapsed: 00:00:00.33 # Mc/sec: 3321.06 // [ok]