# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_184.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_184 [L=221] Description: # 196792 # 197454 # -1 # ID=1_184;partial=00;start_type=GTG;rbs_motif=AGGAGG;rbs_spacer=5-10bp;gc_cont=0.247 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-15 57.5 0.0 1.5e-15 57.3 0.0 1.2 1 Formyl_trans_N Formyl transferase Domain annotation for each model (and alignments): >> Formyl_trans_N Formyl transferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 57.3 0.0 9.3e-20 1.5e-15 84 181 .] 88 182 .. 30 182 .. 0.89 Alignments for each domain: == domain 1 score: 57.3 bits; conditional E-value: 9.3e-20 EEES--S---HHHHHSSTTSEEEEESSSTTTTBSS-HHHHHHHTTSSEEEEEEEE--SSSSTS-EEEEEEEE--TT--HHHHHH CS Formyl_trans_N 84 vlagymkllpkelvqavrlkilniHpSLLPrfkGaaaiqraleaGdketGvtihfvdeelDtGailaqkkveiiaedtkeeleq 167 +l+ +lp+++++++++ +n Hp P+ +G++ ++a++ +k+ Gvt h + +e+D G i+ qk+v+i ++dt l+q 23726_FusoPortal_Gene_184 88 ILVCGAGILPDNFIKKYKV--INSHPGYIPEVRGLDSLKWAIIL-EKKIGVTTHLIGDEVDAGYIIEQKEVPIYENDTFHALSQ 168 55555679********988..********************996.999************************************ PP HHHHHHHHHHHHHH CS Formyl_trans_N 168 rvadaehkalveal 181 rv + e +lv+a+ 23726_FusoPortal_Gene_184 169 RVYETEICMLVDAI 182 ******99999886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (221 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 502 (0.0300383); expected 334.2 (0.02) Passed bias filter: 293 (0.0175323); expected 334.2 (0.02) Passed Vit filter: 21 (0.00125658); expected 16.7 (0.001) Passed Fwd filter: 1 (5.98372e-05); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.23u 0.23s 00:00:00.46 Elapsed: 00:00:00.31 # Mc/sec: 2072.43 // [ok]