# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_1933.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_1933 [L=147] Description: # 2074966 # 2075406 # -1 # ID=1_1933;partial=00;start_type=ATG;rbs_motif=AGGA;rbs_spacer=5-10bp;gc_cont=0.213 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- ------ inclusion threshold ------ 0.032 13.7 2.0 0.031 13.7 1.0 1.6 1 PIRT Phosphoinositide-interacting protein family 0.18 11.3 4.9 0.55 9.6 4.9 1.8 1 Sulf_transp Sulphur transport Domain annotation for each model (and alignments): >> PIRT Phosphoinositide-interacting protein family # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 13.7 1.0 3.8e-06 0.031 81 127 .. 66 113 .. 36 119 .. 0.75 Alignments for each domain: == domain 1 score: 13.7 bits; conditional E-value: 3.8e-06 PIRT 81 evfklsGpaflslGlmllv.cGlvwvpiikkkrkqrqkslflqslksf 127 ++ G ++l +G +++ cG+v +pi rk+ ks + s+k + 23726_FusoPortal_Gene_1933 66 FKYNYKGISILGMGPFVIIcCGVVNIPIWEYLRKKIIKSSYSDSIKEW 113 4567779999****7766527********9999999999999999875 PP >> Sulf_transp Sulphur transport # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 9.6 4.9 6.5e-05 0.55 136 203 .. 7 69 .. 2 145 .. 0.75 Alignments for each domain: == domain 1 score: 9.6 bits; conditional E-value: 6.5e-05 Sulf_transp 136 lvalllliallllvkelrkeklqeaeklektslakklfrkpwslvlgavllgllavlawllsaktgrs 203 + a+l++ia++l+++ k+ + +e ++++kl+r ++s+ + +++l++++ +w++ a + + 23726_FusoPortal_Gene_1933 7 FYAFLCIIAFILVIRFGNKKSILIKE----KKFYHKLLRLKLSTRILTIILAWIFSTTWIVIA-FKYN 69 56788999999999877777666555....789***************************974.3333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (147 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 963 (0.0576233); expected 334.2 (0.02) Passed bias filter: 311 (0.0186094); expected 334.2 (0.02) Passed Vit filter: 26 (0.00155577); expected 16.7 (0.001) Passed Fwd filter: 4 (0.000239349); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.24u 0.24s 00:00:00.48 Elapsed: 00:00:00.32 # Mc/sec: 1335.42 // [ok]