# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_245.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_245 [L=161] Description: # 264358 # 264840 # -1 # ID=1_245;partial=00;start_type=ATG;rbs_motif=GGA/GAG/AGG;rbs_spacer=5-10bp;gc_cont=0.342 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-26 92.8 19.6 2.2e-14 53.4 8.5 2.1 2 ATP-synt_C ATP synthase subunit C Domain annotation for each model (and alignments): >> ATP-synt_C ATP synthase subunit C # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.4 8.5 1.3e-18 2.2e-14 1 60 [] 19 78 .. 19 78 .. 0.99 2 ! 45.4 3.2 4.4e-16 7.3e-12 1 60 [] 95 154 .. 95 154 .. 0.98 Alignments for each domain: == domain 1 score: 53.4 bits; conditional E-value: 1.3e-18 HHHHHHH.GGGHHHHHHHHHHHHHHHHHHHHSGHHHHHHHHHHHHHHHHHHHHHHHHHHH CS ATP-synt_C 1 lgaglavGlsalgsGigiGkagsagiravarnpklftksliilafaeaialygLivalil 60 lga +av ls++gs+ g+G+ag+a+++ + p+ f+k+++++ ++++++lyg++++l++ 23726_FusoPortal_Gene_245 19 LGAVIAVLLSGIGSAKGVGIAGQAAAGLIIDEPEKFGKAMVLQLLPGTQGLYGFVIGLLI 78 79********************************************************98 PP == domain 2 score: 45.4 bits; conditional E-value: 4.4e-16 HHHHHHH.GGGHHHHHHHHHHHHHHHHHHHHSGHHHHHHHHHHHHHHHHHHHHHHHHHHH CS ATP-synt_C 1 lgaglavGlsalgsGigiGkagsagiravarnpklftksliilafaeaialygLivalil 60 l agl vGl +l s++ +G ++ agi+++a+n +tk +++++++e++a+++++++l+l 23726_FusoPortal_Gene_245 95 LMAGLPVGLVGLKSALYQGQVAVAGINILAKNEAHQTKGIVLAVMVETYAVLAFVMSLLL 154 68********************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (161 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 691 (0.0413475); expected 334.2 (0.02) Passed bias filter: 280 (0.0167544); expected 334.2 (0.02) Passed Vit filter: 21 (0.00125658); expected 16.7 (0.001) Passed Fwd filter: 1 (5.98372e-05); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.26u 0.25s 00:00:00.51 Elapsed: 00:00:00.35 # Mc/sec: 1337.23 // [ok]