# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_37.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_37 [L=236] Description: # 49862 # 50569 # -1 # ID=1_37;partial=00;start_type=ATG;rbs_motif=AGGAGG;rbs_spacer=5-10bp;gc_cont=0.294 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-66 221.8 13.0 7.4e-66 221.6 13.0 1.0 1 LrgB LrgB-like family ------ inclusion threshold ------ 0.052 13.4 0.9 0.13 12.1 0.9 1.7 1 SK_channel Calcium-activated SK potassium channel 0.11 12.3 6.9 0.093 12.6 2.9 2.8 2 LrgA LrgA family Domain annotation for each model (and alignments): >> LrgB LrgB-like family # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 221.6 13.0 1.3e-69 7.4e-66 1 213 [. 19 230 .. 19 231 .. 0.99 Alignments for each domain: == domain 1 score: 221.6 bits; conditional E-value: 1.3e-69 LrgB 1 TllaYllakalykklkkpllnPvlvaivliillllllgisyetYkegakilsllLgpa.tVaLAvpLYkqrellkknllaillgl 84 +l+aY ++k++++k+k+ ++nP+l++i+l+i++l++l+i++e+Y +g++i++++++p+ V+++v LY+q+++lk+n+++il+++ 23726_FusoPortal_Gene_37 19 SLIAYEIGKYFFSKTKSIFCNPLLIGIILTIVFLMVLNIPFEAYDKGGSIIKIFISPVeSVIIGVALYEQFQILKRNWFPILVST 103 69******************************************************9878************************* PP LrgB 85 lvgslvsllsavllakllglseelllsllpkSvTtpiAmevseelgGipsltavlviltGilGallgelllkllrikdpvarGla 169 ++gs++s+++ ++l+k++gl++++ ++ lpkSvTt+iA+++++++g ++sl ++++ tGi+Ga++++l+ k+++ +pva+Gla 23726_FusoPortal_Gene_37 104 VLGSTFSIIILYILGKVFGLPDDIFHATLPKSVTTAIALDIASKFGWQESLIPMMTVSTGIIGAVIAPLVTKFMK--SPVAKGLA 186 *************************************************************************99..******** PP LrgB 170 lGtashaiGtakalelgeeagafsslamvlaGiltallaplllk 213 +Gtasha+Gtaka+e+ge++ga+s+la++l++i t++++plll+ 23726_FusoPortal_Gene_37 187 MGTASHAVGTAKAIEMGEVEGAMSGLALSLSAISTSFMIPLLLN 230 ****************************************9975 PP >> SK_channel Calcium-activated SK potassium channel # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.1 0.9 2.3e-05 0.13 15 73 .. 4 62 .. 2 92 .. 0.89 Alignments for each domain: == domain 1 score: 12.1 bits; conditional E-value: 2.3e-05 SK_channel 15 lsdfaLvlalfGivlmvvetEllalavteklsivslalkvlislsTvlLlvlivlYhaa 73 +++ L+ +fGivl ++ E+ + ++++si++ l + i+l+ v+L+vl + + a+ 23726_FusoPortal_Gene_37 4 IINKILFSPFFGIVLSLIAYEIGKYFFSKTKSIFCNPLLIGIILTIVFLMVLNIPFEAY 62 567789999*****************************************998877665 PP >> LrgA LrgA family # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.6 2.9 1.7e-05 0.093 21 89 .. 44 113 .. 35 118 .. 0.70 2 ? -0.6 0.1 0.22 1.2e+03 11 28 .. 128 145 .. 125 179 .. 0.61 Alignments for each domain: == domain 1 score: 12.6 bits; conditional E-value: 1.7e-05 LrgA 21 GlllLlllLltkivklekveeaadfllkhl.allFvPagvgvmeyldllkaellailvalvvstllvlvv 89 G++l +++L+ ++ e +++++++ + ++ v +gv++ e++++lk+++++ilv++v++ +++++ 23726_FusoPortal_Gene_37 44 GIILTIVFLMVLNIPFEAYDKGGSIIKIFIsPVESVIIGVALYEQFQILKRNWFPILVSTVLGSTFSIII 113 555555555555555555555555443333123345689*********************9988877776 PP == domain 2 score: -0.6 bits; conditional E-value: 0.22 LrgA 11 lplpiPgsviGlllLlll 28 ++ ++P+sv + L ++ 23726_FusoPortal_Gene_37 128 FHATLPKSVTTAIALDIA 145 566666666665555444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (236 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 743 (0.0444591); expected 334.2 (0.02) Passed bias filter: 290 (0.0173528); expected 334.2 (0.02) Passed Vit filter: 17 (0.00101723); expected 16.7 (0.001) Passed Fwd filter: 5 (0.000299186); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 3 [number of targets reported over threshold] # CPU time: 0.27u 0.25s 00:00:00.52 Elapsed: 00:00:00.33 # Mc/sec: 2078.97 // [ok]