# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_437.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_437 [L=72] Description: # 483043 # 483258 # -1 # ID=1_437;partial=00;start_type=ATG;rbs_motif=AGGA;rbs_spacer=5-10bp;gc_cont=0.255 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-25 88.9 0.5 1.4e-25 88.8 0.5 1.0 1 S4_2 S4 domain 3e-05 23.5 0.2 6e-05 22.6 0.2 1.6 1 S4 S4 domain Domain annotation for each model (and alignments): >> S4_2 S4 domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.8 0.5 1.7e-29 1.4e-25 1 64 [. 7 70 .. 7 71 .. 0.97 Alignments for each domain: == domain 1 score: 88.8 bits; conditional E-value: 1.7e-29 S4_2 1 ieiedeyItLgqlLKlaglvesGgeaKafiaegeVkvNGevetrRgkKlraGdvVeidgetiev 64 ++i++e+I+L+q+LK++ +v+sG +aK++i +g+VkvN+evetrRg+K++++ Vei ++ + v 23726_FusoPortal_Gene_437 7 VKISTEFIKLDQFLKWLAVVDSGSDAKQVILDGKVKVNDEVETRRGRKIYPEYKVEIFDKIYVV 70 69*******************************************************9999887 PP >> S4 S4 domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.6 0.2 7.2e-09 6e-05 2 39 .. 15 52 .. 14 67 .. 0.88 Alignments for each domain: == domain 1 score: 22.6 bits; conditional E-value: 7.2e-09 EHHHHHHHTTSSSSHHHHHHHHHTTTEEETTEEE-.TT CS S4 2 RLdkvlarlglassrreArqlIehGrVlVNGkvvkdps 39 Ld++l+ l + s + A+q I +G+V+VN +v + + 23726_FusoPortal_Gene_437 15 KLDQFLKWLAVVDSGSDAKQVILDGKVKVNDEVETRRG 52 69****77999********************9988655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (72 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 372 (0.0222595); expected 334.2 (0.02) Passed bias filter: 248 (0.0148396); expected 334.2 (0.02) Passed Vit filter: 25 (0.00149593); expected 16.7 (0.001) Passed Fwd filter: 2 (0.000119674); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.21u 0.23s 00:00:00.44 Elapsed: 00:00:00.30 # Mc/sec: 697.69 // [ok]