# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_76.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_76 [L=101] Description: # 98139 # 98441 # -1 # ID=1_76;partial=00;start_type=ATG;rbs_motif=GGAG/GAGG;rbs_spacer=5-10bp;gc_cont=0.238 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-09 38.4 2.7 1.5e-09 37.9 2.7 1.2 1 GIY-YIG GIY-YIG catalytic domain ------ inclusion threshold ------ 0.022 14.1 0.7 0.1 11.9 0.6 1.9 1 G3P_antiterm Glycerol-3-phosphate responsive antiterminator Domain annotation for each model (and alignments): >> GIY-YIG GIY-YIG catalytic domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.9 2.7 1.8e-13 1.5e-09 2 77 .. 3 75 .. 2 76 .. 0.93 Alignments for each domain: == domain 1 score: 37.9 bits; conditional E-value: 1.8e-13 -EEEEEEETTT--EEEEEESSHHHHHHHHHHHHHHT--S-HS.STEEEEEEEE----HHHHHHHHHHHHHHTTSSS CS GIY-YIG 2 ggvYiirskenkliYvGstknlekRlkqHnagkkakytrkkgkkpfeliileifptksealelEkklikkyksnky 77 ++ Y++r++++++ Y+G +k+ kR +H++ k+akyt+ +k++++ + ++++s a +lE +++k k++k 23726_FusoPortal_Gene_76 3 YYLYMLRCEDGSI-YTGVAKDYLKRYEEHLSAKGAKYTKS--HKVVKIERVFLCDSRSIACSLESEIKKYIKKKKE 75 89**********5.*************************9..9*****************9***999998887665 PP >> G3P_antiterm Glycerol-3-phosphate responsive antiterminator # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.9 0.6 1.3e-05 0.1 83 110 .. 36 63 .. 30 99 .. 0.75 Alignments for each domain: == domain 1 score: 11.9 bits; conditional E-value: 1.3e-05 HHHHHHTT--EEEEEE--SHHHHHHHHH CS G3P_antiterm 83 ikkakklglltiqrlfliDssalekalk 110 k+ k+++++ i r+fl+Ds+++ +l+ 23726_FusoPortal_Gene_76 36 AKYTKSHKVVKIERVFLCDSRSIACSLE 63 578999***************9876554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (101 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 1201 (0.0718645); expected 334.2 (0.02) Passed bias filter: 461 (0.027585); expected 334.2 (0.02) Passed Vit filter: 17 (0.00101723); expected 16.7 (0.001) Passed Fwd filter: 2 (0.000119674); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.22u 0.24s 00:00:00.46 Elapsed: 00:00:00.32 # Mc/sec: 917.53 // [ok]