# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_827.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_827 [L=210] Description: # 926186 # 926815 # 1 # ID=1_827;partial=00;start_type=ATG;rbs_motif=AGGAG;rbs_spacer=5-10bp;gc_cont=0.200 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 0.0026 17.8 0.8 0.0044 17.0 0.2 1.6 2 DUF2670 Protein of unknown function (DUF2670) Domain annotation for each model (and alignments): >> DUF2670 Protein of unknown function (DUF2670) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 17.0 0.2 2.6e-07 0.0044 26 101 .. 5 80 .. 2 94 .. 0.76 2 ? -2.1 0.0 0.22 3.6e+03 15 29 .. 122 136 .. 115 165 .. 0.65 Alignments for each domain: == domain 1 score: 17.0 bits; conditional E-value: 2.6e-07 DUF2670 26 yliiavaslitlyytvlglkkigfid....yfteetveilstskavaqnciiklklvngklplvefwdclsdpgeykyee 101 +l+ ++ s+i++ +t++g+k++ + + yf e+ ++i ++ +++n kl+ + l +++ + d + k e+ 23726_FusoPortal_Gene_827 5 FLVPTILSIISICFTIIGIKRLSLFQnwqvYFEENKEKIRQQ-EKITDNIFNKLNS---RAGLIPYFNIILDDSKIKEEN 80 6778899***************97653444777777776655.5689******995...555566777777777776665 PP == domain 2 score: -2.1 bits; conditional E-value: 0.22 DUF2670 15 gfflwsivtkwylii 29 ++++ + k+y ++ 23726_FusoPortal_Gene_827 122 SYIVYNYLDKYYAMV 136 555555555555443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (210 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 992 (0.0593585); expected 334.2 (0.02) Passed bias filter: 491 (0.0293801); expected 334.2 (0.02) Passed Vit filter: 32 (0.00191479); expected 16.7 (0.001) Passed Fwd filter: 1 (5.98372e-05); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.23u 0.23s 00:00:00.46 Elapsed: 00:00:00.31 # Mc/sec: 1969.28 // [ok]