# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_828.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_828 [L=73] Description: # 927306 # 927524 # 1 # ID=1_828;partial=00;start_type=ATG;rbs_motif=GGAG/GAGG;rbs_spacer=5-10bp;gc_cont=0.279 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 0.008 16.0 0.0 0.011 15.5 0.0 1.2 1 DUF1778 Protein of unknown function (DUF1778) ------ inclusion threshold ------ 0.014 15.3 0.0 0.022 14.6 0.0 1.3 1 RHH_1 Ribbon-helix-helix protein, copG family Domain annotation for each model (and alignments): >> DUF1778 Protein of unknown function (DUF1778) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 15.5 0.0 1.3e-06 0.011 3 34 .. 6 37 .. 5 42 .. 0.91 Alignments for each domain: == domain 1 score: 15.5 bits; conditional E-value: 1.3e-06 DUF1778 3 elRispeakeliqrAAalsgktltdFvleaal 34 +lR+++ +k++iq A+ +g t+++Fv + +l 23726_FusoPortal_Gene_828 6 TLRLDETEKAIIQDYASSKGMTMSEFVKRVVL 37 68************************977665 PP >> RHH_1 Ribbon-helix-helix protein, copG family # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.6 0.0 2.7e-06 0.022 3 38 .. 6 41 .. 6 42 .. 0.96 Alignments for each domain: == domain 1 score: 14.6 bits; conditional E-value: 2.7e-06 EEEEEHHHHHHHHHHHHHHTSSHHHHHHHHHHHHHH CS RHH_1 3 sirldeellerLdelarrrgrSrSelIReAlreyle 38 ++rlde +++ ++ a g+++Se++++ +++y+e 23726_FusoPortal_Gene_828 6 TLRLDETEKAIIQDYASSKGMTMSEFVKRVVLDYIE 41 789*******************************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (73 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 706 (0.0422451); expected 334.2 (0.02) Passed bias filter: 378 (0.0226185); expected 334.2 (0.02) Passed Vit filter: 40 (0.00239349); expected 16.7 (0.001) Passed Fwd filter: 2 (0.000119674); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.20u 0.23s 00:00:00.43 Elapsed: 00:00:00.30 # Mc/sec: 707.38 // [ok]