# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_831.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_831 [L=204] Description: # 928644 # 929255 # 1 # ID=1_831;partial=00;start_type=ATG;rbs_motif=None;rbs_spacer=None;gc_cont=0.271 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-25 88.0 0.0 6e-25 87.6 0.0 1.2 1 rve Integrase core domain 4.1e-23 81.2 3.1 1e-22 79.9 3.1 1.7 1 rve_2 Integrase core domain 6.3e-13 48.2 0.0 1.6e-12 46.9 0.0 1.7 2 rve_3 Integrase core domain 2.1e-07 31.1 1.3 3.3e-07 30.5 1.3 1.3 1 DDE_Tnp_IS240 DDE domain Domain annotation for each model (and alignments): >> rve Integrase core domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.6 0.0 1.4e-28 6e-25 2 118 .. 38 152 .. 37 153 .. 0.96 Alignments for each domain: == domain 1 score: 87.6 bits; conditional E-value: 1.4e-28 rve 2 trpgelwqvDvtvvripdgggkayllvviddfsrlilaealsdemdastvlalleravarfggvepervlsDngseytskafre 85 t+p+++w +Dvt+++ +g+k+yl ++d++ r+i+ + +s++ + +++ ++l+ a++ + e ++++sD+g++y+ +++e 23726_FusoPortal_Gene_831 38 TAPNQKWFTDVTEFN--LRGEKLYLSPILDAYGRYIVSYDISRSPNLEQINHMLNLAFKEKENYENLIFHSDQGWQYQHYSYQE 119 79*************..44558************************************************************** PP rve 86 flaelgirvsftrpgrpqdnGkvErfnrtlkde 118 l+e +i++s++r+g++ dnG++E f+++lk e 23726_FusoPortal_Gene_831 120 RLKEKKITQSMSRKGNSLDNGLMECFFGLLKSE 152 *******************************87 PP >> rve_2 Integrase core domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.9 3.1 2.5e-26 1e-22 1 52 [] 143 200 .. 143 200 .. 0.94 Alignments for each domain: == domain 1 score: 79.9 bits; conditional E-value: 2.5e-26 rve_2 1 EsfFgsLKtElvyge..tfktleeleaaiedYIewYNnkR....lkglsPvqYrnqsL 52 E+fFg+LK+E++y++ ++ktleel++aiedYI++YNnkR lkgl+P++Yr+qsL 23726_FusoPortal_Gene_831 143 ECFFGLLKSEMFYEQeeKYKTLEELKEAIEDYIYYYNNKRikekLKGLTPASYRSQSL 200 9*************999***********************666667**********98 PP >> rve_3 Integrase core domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.2 0.0 1.7 7.2e+03 30 41 .. 39 50 .. 32 53 .. 0.69 2 ! 46.9 0.0 3.9e-16 1.6e-12 2 67 .] 125 192 .. 124 192 .. 0.97 Alignments for each domain: == domain 1 score: -3.2 bits; conditional E-value: 1.7 rve_3 30 llneelfrslae 41 + n+++f++++e 23726_FusoPortal_Gene_831 39 APNQKWFTDVTE 50 557888887776 PP == domain 2 score: 46.9 bits; conditional E-value: 3.9e-16 rve_3 2 gielsyiapgkPqqNglvEsfngtlrdellneel..frslaearekleawredYNteRPHssLgykTP 67 +i++s+++ g +Ngl+E f+g l+ e+ +e+ +++l+e++e++e+++ +YN++R + L+++TP 23726_FusoPortal_Gene_831 125 KITQSMSRKGNSLDNGLMECFFGLLKSEMFYEQEekYKTLEELKEAIEDYIYYYNNKRIKEKLKGLTP 192 799****************************999999******************************9 PP >> DDE_Tnp_IS240 DDE domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.5 1.3 7.8e-11 3.3e-07 2 137 .. 42 182 .. 41 185 .. 0.89 Alignments for each domain: == domain 1 score: 30.5 bits; conditional E-value: 7.8e-11 DDE_Tnp_IS240 2 kswrvDETyvkikGkwaYlyravDkegr.ildflvskrRdtkaakaflrkalkkek.lepeeivtDkasayas.alkelkrege 82 ++w D T +G++ Yl ++D+ gr i+ + +s + ++ +l+ a+k+++ +e+ + D y++ +e +e + 23726_FusoPortal_Gene_831 42 QKWFTDVTEFNLRGEKLYLSPILDAYGRyIVSYDISRSPNLEQINHMLNLAFKEKEnYENLIFHSDQGWQYQHySYQERLKEKK 125 68999************************************************99989********988887525566556678 PP DDE_Tnp_IS240 83 lfdevshvqvkylnnriEsdhrtlKkrl..rptrgfkslksaaktlagfeavknlrk 137 ++++s+ n +E + lK ++ ++ ++ k+l++++++++ + ++n ++ 23726_FusoPortal_Gene_831 126 ITQSMSRKGNSLDNGLMECFFGLLKSEMfyEQEEKYKTLEELKEAIEDYIYYYNNKR 182 889999999999999**********9885577899******************9887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (204 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 1249 (0.0747367); expected 334.2 (0.02) Passed bias filter: 507 (0.0303375); expected 334.2 (0.02) Passed Vit filter: 49 (0.00293202); expected 16.7 (0.001) Passed Fwd filter: 4 (0.000239349); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 4 [number of targets reported over threshold] # CPU time: 0.23u 0.23s 00:00:00.46 Elapsed: 00:00:00.30 # Mc/sec: 1976.78 // [ok]