# hmmscan :: search sequence(s) against a profile database # HMMER 3.1b2 (February 2015); http://hmmer.org/ # Copyright (C) 2015 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: AA/23726_FusoPortal_Gene_849.faa # target HMM database: Pfam-A.hmm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 23726_FusoPortal_Gene_849 [L=319] Description: # 946461 # 947417 # -1 # ID=1_849;partial=00;start_type=ATG;rbs_motif=GGAGG;rbs_spacer=5-10bp;gc_cont=0.247 Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- ------ inclusion threshold ------ 0.048 13.9 0.1 0.048 13.9 0.1 2.2 2 CstA_5TM 5TM C-terminal transporter carbon starvation CstA Domain annotation for each model (and alignments): >> CstA_5TM 5TM C-terminal transporter carbon starvation CstA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.0 1.3 0.062 1e+03 82 112 .. 177 207 .. 174 210 .. 0.78 2 ? 13.9 0.1 2.9e-06 0.048 4 41 .. 223 260 .. 220 302 .. 0.79 Alignments for each domain: == domain 1 score: -0.0 bits; conditional E-value: 0.062 CstA_5TM 82 laLlvvtvwllktgrkalvtliPmvfmlvvt 112 +aLl + +++l ++v++iP+++ ++ + 23726_FusoPortal_Gene_849 177 VALLGILAYVLAGIAGYYVWAIPAFLTAMAS 207 7999999999986668999999998776655 PP == domain 2 score: 13.9 bits; conditional E-value: 2.9e-06 CstA_5TM 4 aytfailfvalfalTtlDtatRlaRyilqellgelkka 41 ++f++l+++lf++T l+ + Rl R+ +e++ ++ + 23726_FusoPortal_Gene_849 223 FVIFILLAISLFIATFLEYTWRLYRFYKEEYIVTFGEV 260 5789**************************99887743 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (319 residues searched) Target model(s): 16712 (2907032 nodes) Passed MSV filter: 1414 (0.0846099); expected 334.2 (0.02) Passed bias filter: 642 (0.0384155); expected 334.2 (0.02) Passed Vit filter: 58 (0.00347056); expected 16.7 (0.001) Passed Fwd filter: 1 (5.98372e-05); expected 0.2 (1e-05) Initial search space (Z): 16712 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.25u 0.20s 00:00:00.45 Elapsed: 00:00:00.28 # Mc/sec: 3311.94 // [ok]