F. necrophorum 1_1_36S_FusoPortal_Gene_301

InterPro predicted function: Ribosomal protein L34
InterPro Accessions: IPR000271

Link to full Interpro analysis


Previous Gene Next Gene

Return to complete Genome Map of F. necrophorum 1_1_36S

FASTA file of all annotated F. necrophorum 1_1_36S genes - Amino Acids | FASTA file of all annotated F. necrophorum 1_1_36S genes - DNA

Additional Links

Hidden Markov Model (HMMScan) for domains: 1_1_36S_FusoPortal_Gene_301.out

Amino Acids: 44

ORF FASTA file - Amino Acids

MKRTFQPNTRKRKKDHGFRSRMATKNGRKVLKRRRARGRQVLSA

Coding DNA - Genome Coordinates: 304403-304269 | Orientation: Reverse

ORF FASTA file - Coding DNA

ATGAAGAGAACATTCCAACCTAACACAAGAAAAAGAAAAAAAGATCATGGGTTTAGATCTAGAATGGCAA CTAAAAACGGAAGAAAAGTGTTAAAGAGAAGAAGAGCTAGAGGAAGACAAGTACTATCAGCATAA

Previous Gene Next Gene