F. periodonticum 2_1_31_FusoPortal_Gene_1645

InterPro predicted function: Uncharacterised conserved protein UCP015278
InterPro Accessions: IPR016630

Link to full Interpro analysis


Previous Gene Next Gene

Return to complete Genome Map of F. periodonticum 2_1_31

FASTA file of all annotated F. periodonticum 2_1_31 genes - Amino Acids | FASTA file of all annotated F. periodonticum 2_1_31 genes - DNA

Additional Links

Hidden Markov Model (HMMScan) for domains: 2_1_31_FusoPortal_Gene_1645.out

Amino Acids: 43

ORF FASTA file - Amino Acids

MITLEDFKNNISPQEYYTEENYIYLYNRHLDWIRDKSDYLNGK

Coding DNA - Genome Coordinates: 1720126-1719995 | Orientation: Reverse

ORF FASTA file - Coding DNA

ATGATAACTTTAGAGGATTTTAAAAATAATATTTCTCCACAAGAATATTATACTGAAGAAAATTATATAT ATTTGTATAACAGACATTTAGATTGGATTAGAGATAAAAGTGATTATCTAAATGGGAAATAA

Previous Gene Next Gene