F. periodonticum 2_1_31_FusoPortal_Gene_2200

InterPro predicted function:
InterPro Accessions:

Link to full Interpro analysis


Previous Gene Next Gene

Return to complete Genome Map of F. periodonticum 2_1_31

FASTA file of all annotated F. periodonticum 2_1_31 genes - Amino Acids | FASTA file of all annotated F. periodonticum 2_1_31 genes - DNA

Additional Links

Hidden Markov Model (HMMScan) for domains: 2_1_31_FusoPortal_Gene_2200.out

Amino Acids: 41

ORF FASTA file - Amino Acids

METYRNYNREDFNKILSAKITRKLLRTATVLAALGILNKTF

Coding DNA - Genome Coordinates: 2321611-2321486 | Orientation: Reverse

ORF FASTA file - Coding DNA

ATGGAAACTTATAGAAACTATAATAGAGAGGATTTTAATAAAATTCTTTCAGCGAAAATTACAAGAAAAT TACTTAGAACAGCTACTGTACTAGCTGCTTTAGGTATATTAAACAAAACATTTTAA

Previous Gene Next Gene