F. periodonticum 2_1_31_FusoPortal_Gene_2242

InterPro predicted function: Ribosomal protein L29/L35
InterPro Accessions: IPR001854

Link to full Interpro analysis


Previous Gene Next Gene

Return to complete Genome Map of F. periodonticum 2_1_31

FASTA file of all annotated F. periodonticum 2_1_31 genes - Amino Acids | FASTA file of all annotated F. periodonticum 2_1_31 genes - DNA

Additional Links

Hidden Markov Model (HMMScan) for domains: 2_1_31_FusoPortal_Gene_2242.out

Amino Acids: 60

ORF FASTA file - Amino Acids

MRAKEIREMTSEDLVVKCKELKEELFNLKFQLSLGQLTNTAKIREVRREIARINTILNER

Coding DNA - Genome Coordinates: 2372412-2372594 | Orientation: Forward

ORF FASTA file - Coding DNA

ATGAGAGCTAAAGAAATAAGAGAAATGACTAGTGAAGACCTAGTTGTTAAGTGTAAAGAGCTAAAAGAAG AATTATTCAACTTGAAGTTCCAACTTTCATTAGGTCAACTAACTAATACAGCTAAAATAAGAGAAGTTAG AAGAGAAATTGCAAGAATCAACACTATCTTAAATGAAAGATAA

Previous Gene Next Gene