F. mortiferum 9817_FusoPortal_Gene_2174

InterPro predicted function:
InterPro Accessions:

Link to full Interpro analysis


Previous Gene Next Gene

Return to complete Genome Map of F. mortiferum 9817

FASTA file of all annotated F. mortiferum 9817 genes - Amino Acids | FASTA file of all annotated F. mortiferum 9817 genes - DNA

Additional Links

Hidden Markov Model (HMMScan) for domains: 9817_FusoPortal_Gene_2174.out

Amino Acids: 36

ORF FASTA file - Amino Acids

MNNYDTATNTLEKNSEEQTKSILELIKKFTDERKDD

Coding DNA - Genome Coordinates: 2213733-2213843 | Orientation: Forward

ORF FASTA file - Coding DNA

ATGAATAACTATGATACAGCTACAAATACACTAGAAAAAAATAGTGAAGAACAAACTAAATCTATTCTTG AGCTTATAAAAAAATTTACTGATGAAAGGAAAGATGATTAG

Previous Gene Next Gene