F. gonidiaformans 25563_FusoPortal_Gene_312

InterPro predicted function:
InterPro Accessions:

Link to full Interpro analysis


Previous Gene Next Gene

Return to complete Genome Map of F. gonidiaformans 25563

FASTA file of all annotated F. gonidiaformans 25563 genes - Amino Acids | FASTA file of all annotated F. gonidiaformans 25563 genes - DNA

Additional Links

Hidden Markov Model (HMMScan) for domains: 25563_FusoPortal_Gene_312.out

Amino Acids: 31

ORF FASTA file - Amino Acids

MKLETLKALIKQYGNITFLELQERLTGGLYE

Coding DNA - Genome Coordinates: 328925-328830 | Orientation: Reverse

ORF FASTA file - Coding DNA

ATGAAATTAGAAACACTAAAGGCTTTAATCAAACAATATGGAAATATCACTTTTTTAGAACTTCAAGAAA GACTTACAGGTGGTCTTTATGAATAA

Previous Gene Next Gene